Analysis of websites containing myfirstfarmers.checkingnavigator.com backlinks
These websites are/were linking to myfirstfarmers.checkingnavigator.com.
Websites found: 1
Number of websited displayed: 1
List of results:
First Farmers Bank | Banking, Wealth Management & Trusthttp://site-overview.com/stats/myfirstfarmers.com
Banking | Wealth Management | Trust
- Google Analytics ID: 54711931-1
- Website Address renewal date: 10/2/25
- Domain Address Reg. date: 09/4/29
- Website address in use until: 19/4/29