HTTP Information: |
---|
Expires: -1
Cache-Control: no-cache
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Wix-Renderer-Server: app-jvm-21-0.84.wixprod.net
Pragma: no-cache
Connection: keep-alive
X-Seen-By: BTnOiHJfychu5uLth4+AW8dGeYGpVyoUSMKAdIe0cbQ=,1wy2ILu/S4rlWT/R4rqCrVbmXE/o2wHC/BXzSPnkxYo=,LwsIp90Tma5sliyMxJYVEthWsKYOO1+wUWoDHg6PvM5YgeUJqUXtid+86vZww+nL,I2ZOrNA1LIowGTY6Ll7mx/ayVZxVTGytySOSc+GvWuU=,1wy2ILu/S4rlWT/R4rqCrV/JMDd4gilr2uGoEO7PurY=,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODq6NNL91a3Di10jVZVVuAn
X-Wix-Request-Id: 1519565755.62631446020453025757
Set-Cookie: svSession=b91fb7c705896492b6ed09768c84fe788d91c80dec74df47446667470a1e978464319bcbde51360b8952738a9518cd8a1e60994d53964e647acf431e4f798bcde6ab34b9f79743876d05d25e4f19fbd877016759ad92bf6be599c6d8e3f58f35;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;Expires=Tue, 25-Feb-2020 13:35:54 GMT
X-Wix-Server-Artifact-Id: wix-public-war
transfer-encoding: chunked
Content-Language: en
Server: Pepyaka/1.13.7
Set-Cookie: XSRF-TOKEN=1519565755|CqBnzboS01dn;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk
Date: Sun, 25 Feb 2018 13:35:55 GMT
HTTP/1.1 200 OK
Content-Type: text/html;charset=utf-8
ETag: 56621063678c190c3b8324b756765260
Set-Cookie: hs=-257059143;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;HttpOnly
Vary: User-Agent
|
Other profiles | |
---|---|
Google Analytics ID: | 88171084-1 |
Known AddThis user account: | Information does not apply |
Google Adsense Publisher: | Information does not apply |
Google+ Identity: | Information does not apply |
Whois details | |
---|---|
Website address in use until: | Data unavailable |
Unedited Whois Data: | |
Error for "pheaseyparkfarmchildrenscentrenursery.co.uk". the WHOIS query quota for No email disclosed has been exceeded and will be replenished in 56 seconds WHOIS lookup made at 15:24:23 12-Feb-2018 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2018. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at http://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time. | |
Domain Address Reg. date: | Data unavailable |
Website Address renewal date: | 18/2/15 |
DNS information | ||
---|---|---|
DE; Germany; NW; North Rhine-Westphalia; Hoest; 47652; Europe/Berlin; 51.65000000; 6.18330000 | ns2.123-reg.co.uk | 62.138.132.21 |
GB; United Kingdom; Europe/London; 51.49640000; -0.12240000 | ns.123-reg.co.uk | 212.67.202.2 |
What others say |
---|
Safety overview | |
---|---|
WOT Child Safety Rank: | Data unavailable |
WOT Safety Rank: | Data unavailable |
Google Safe assessment: | Data unavailable |
Relation to all content | Main tag words | Times search keyword used |
---|---|---|
Data unavailable | Education | Data unavailable |
Data unavailable | Pheasey Park Farm | Data unavailable |
Data unavailable | Children's Centre Nursery | Data unavailable |
Data unavailable | Home | Data unavailable |
Alexa ranking information | |
---|---|
Past year global rank trend | |
Last Alexa data update: | 18/6/1 |
Ranking delta: | +196 960 |
Country ranking: | Data unavailable |
Links | |
Information does not apply | |
One month trend average stats | |
Global/International rating: | 744 820 |
Target Country: | Data unavailable |
Position based on reach: | Data unavailable |
Detailed index page overview | |
---|---|
Top external pages linked to | |
| |
IP of the host server: | 54.171.1.43 |
Physical server location: | IE; Ireland; L; Leinster; Dublin; Europe/Dublin; 53.33890000; -6.25950000 |