Site-Overview.com
 

Domain names that are using 23.229.149.233

The list you see here contains websites hosted on server IP 23.229.149.233.

 
Websites found: 4
Number of websited displayed: 4
 

List of results:

My blog | Just another WordPress site
http://site-overview.com/stats/ypt230.com
  • Website Address renewal date: 17/1/24
  • Domain Address Reg. date: 13/1/13
  • Website address in use until: 18/1/13
Журнал ITALIA REPORT - интересное об Италии
http://site-overview.com/stats/italiareport.com
ITALIA REPORT - журнал, который раскрывает все тайны Италии. Это изобилие самой полезной информации не только о туризме, моде, искусстве, но так же и самые эффективные советы для любителей активного отдыха. Это необыкновенный мир роскоши и приключений, захватывающие истории и секреты успеха итальянцев.
  • Google+ Identity: 108164337562581937463
  • Website Address renewal date: 17/5/25
  • Domain Address Reg. date: 14/5/27
  • Website address in use until: 18/5/27
breakfastsandwichmakerreviews.com
http://site-overview.com/stats/breakfastsandwichmakerreviews.com
  • Website Address renewal date: 16/12/25
  • Domain Address Reg. date: 13/12/21
  • Website address in use until: 17/12/21
Sushi 88 & Ramen | 506 Showers Dr. Mountain View, CA 94040
http://site-overview.com/stats/sushi88ramen.com
  • Google+ Identity: 116391221818243995340
  • Website Address renewal date: 17/1/2
  • Domain Address Reg. date: 11/12/29
  • Website address in use until: 18/12/29
2024-05-22 07:18:33 ... 0.0955